PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000740927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 89aa    MW: 9632.07 Da    PI: 5.0182
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000740927genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.91.5e-17148149
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                   + pGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePw+Lp 
  MDP0000740927  1 MSPGFRFHPTDEELITCYLMNKINDATFTG-RAIADVDLNKCEPWELPG 48
                   579************************999.89**************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100516.158188IPR003441NAC domain
SuperFamilySSF1019411.44E-17250IPR003441NAC domain
PfamPF023655.6E-8344IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MSPGFRFHPT DEELITCYLM NKINDATFTG RAIADVDLNK CEPWELPGAG RRGVPLRIGD  60
DYMCDGVGCD RVGTRVVAPV RVAVGNCM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002280812.11e-27PREDICTED: protein CUP-SHAPED COTYLEDON 2
RefseqXP_010648442.11e-27PREDICTED: protein CUP-SHAPED COTYLEDON 2
SwissprotO040171e-22NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLD7SU401e-27D7SU40_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g02710.t013e-27(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1758457
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.22e-24NAC domain containing protein 38